PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pahal.G00313.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family MIKC_MADS
Protein Properties Length: 179aa    MW: 20793.2 Da    PI: 10.198
Description MIKC_MADS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pahal.G00313.1genomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1SRF-TF75.93.2e-241056248
                    ---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEE CS
          SRF-TF  2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklye 48
                    rien   rqvtf+kRr g+lKKA+ELSvLCda++ vi++s++g++y+
  Pahal.G00313.1 10 RIENPVHRQVTFCKRRMGLLKKAKELSVLCDADIGVIVVSPHGRIYD 56
                    8*******************************************997 PP

2K-box54.16.6e-1975158284
           K-box   2 qkssgksleeakaeslqqelakLkkeienLqreqRhllGe.dLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkke 84 
                      + +g+s e++k++  qqe+  L +ei+  q+ +R + Ge d++ ++l eLq Le++Le  + +iRs+K++++ ++ie l++k 
  Pahal.G00313.1  75 SEMHGESSEQNKTQAIQQEVLALTREIDLFQKGLRYIHGEkDINHMNLGELQALENNLEMWVHNIRSQKMQIMSREIEMLRNKV 158
                     5677888999*****************************868***************************************996 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF554552.09E-26173IPR002100Transcription factor, MADS-box
SMARTSM004322.6E-33160IPR002100Transcription factor, MADS-box
PROSITE profilePS5006628.469161IPR002100Transcription factor, MADS-box
CDDcd002659.37E-35273No hitNo description
PRINTSPR004041.6E-24323IPR002100Transcription factor, MADS-box
PROSITE patternPS003500357IPR002100Transcription factor, MADS-box
PfamPF003198.4E-231055IPR002100Transcription factor, MADS-box
PRINTSPR004041.6E-242338IPR002100Transcription factor, MADS-box
PRINTSPR004041.6E-243859IPR002100Transcription factor, MADS-box
PfamPF014861.9E-2181159IPR002487Transcription factor, K-box
PROSITE profilePS5129711.37487178IPR002487Transcription factor, K-box
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0046983Molecular Functionprotein dimerization activity
Sequence ? help Back to Top
Protein Sequence    Length: 179 aa     Download sequence    Send to blast
MARGKVQMRR IENPVHRQVT FCKRRMGLLK KAKELSVLCD ADIGVIVVSP HGRIYDLATN  60
GNMQGLIERY RRTYSEMHGE SSEQNKTQAI QQEVLALTRE IDLFQKGLRY IHGEKDINHM  120
NLGELQALEN NLEMWVHNIR SQKMQIMSRE IEMLRNKVGS ASVTLFMHLT KIYIQRRD*
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankEU9761311e-145EU976131.1 Zea mays clone 645550 hypothetical protein mRNA, complete cds.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004975710.11e-109PREDICTED: MADS-box transcription factor 26-like
SwissprotA2YQK95e-64MAD26_ORYSI; MADS-box transcription factor 26
SwissprotQ0J8G85e-64MAD26_ORYSJ; MADS-box transcription factor 26
TrEMBLK3YEG81e-109K3YEG8_SETIT; Uncharacterized protein
STRINGSi012632m1e-108(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP149136112
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G71692.13e-52AGAMOUS-like 12